PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G114461_P01
Common NameLOC100280229
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family FAR1
Protein Properties Length: 704aa    MW: 80279.7 Da    PI: 7.7826
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G114461_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA43.64e-144480135
               GATA  1 CsnCgttk..TplWRrgpdgnktLCnaCGlyyrkkgl 35
                       C  Cg +   Tp++Rrgpdg++tLCnaCG+ yrk ++
  GRMZM2G114461_P01 44 CLRCGISGnaTPHMRRGPDGPRTLCNACGIAYRKGKM 80
                       5667777777************************876 PP

2FAR183.14.7e-26114201191
               FAR1   1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHelap 91 
                        +fYn+YA +vGFsvrks+s+ks++n  ++ rtfvCs+eg+++++k+   +++++r  tr+gC a+l +k + + k++vt+++ +HnH+lap
  GRMZM2G114461_P01 114 EFYNKYAGHVGFSVRKSTSHKSSENI-TKVRTFVCSREGYNRDKKSL--EAKKPRLDTRIGCPARLIIKVTPECKYRVTDFKADHNHQLAP 201
                        6*********************6666.899*************9988..99*************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004013.7E-63793IPR000679Zinc finger, GATA-type
SuperFamilySSF577162.42E-104091No hitNo description
Gene3DG3DSA:3.30.50.103.8E-114382IPR013088Zinc finger, NHR/GATA-type
CDDcd002028.86E-84381No hitNo description
PfamPF003201.2E-114479IPR000679Zinc finger, GATA-type
PfamPF031012.1E-23114201IPR004330FAR1 DNA binding domain
PfamPF105511.2E-25324418IPR018289MULE transposase domain
PROSITE profilePS509669.878592639IPR007527Zinc finger, SWIM-type
PfamPF044344.9E-5610638IPR007527Zinc finger, SWIM-type
SMARTSM005753.8E-6614641IPR006564Zinc finger, PMZ-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 704 aa     Download sequence    Send to blast
MMHMLVAPDR GGGELQPYVA PPAEQELELL RDNADDGLEG HVRCLRCGIS GNATPHMRRG  60
PDGPRTLCNA CGIAYRKGKM RRMIEAEPPI DEAALAKLVP EVGMEFVSEE KAYEFYNKYA  120
GHVGFSVRKS TSHKSSENIT KVRTFVCSRE GYNRDKKSLE AKKPRLDTRI GCPARLIIKV  180
TPECKYRVTD FKADHNHQLA PPSTMHMLRS QRILTELQPG EAELSDDSVV TPTTKATGDL  240
VVRQVSFLRS LSLLPADYKN YLRSKRMKAM QPGDGGAILK YLQTMQMDNP SFFYTMQIDE  300
DDKLTNFFWA DQKSRDDFNY FGDVLCLDTT YKINGYGRPL ALFLGVNHHK QTIIFGAAML  360
YDESFDSYKW LFDSFKIAMH GKQPAVALID QSIPLSSAMA AAWPSTTQRI CAWHVYQNSL  420
KHLNHVFQGS KTFAKDFGKC VFGYEDEDEF VFSWRSMLEK YDLRHNEWLS KVFAEKEQWA  480
LAYDRHIFCA DIISALQAES FSSILKKFLS PQLELLSFFK HYERAVDEHR YAELQADFQA  540
SQSYPRIPPA KMLKQTAHTY TPVVFEIFRK EFELFMDSVL FSCGEAGTTS EYKVASSEKP  600
KEHFVRFDSS DCSCLCTCRK FEFMGIPCCH MLKVLDYRNI KELPQKYLLK RWRRTAKSAN  660
EDNEGNATNA NNGSLLIVPA PPTNHHGLQS FSAMIQDASV SSMH
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.835040.0embryo| leaf| meristem| ovary| shoot
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G114461
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G114461_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0558180.0BT055818.1 Zea mays full-length cDNA clone ZM_BFb0212N15 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001146631.10.0FAR1 transcription factor
TrEMBLB8A2M60.0B8A2M6_MAIZE; FAR1 transcription factor
STRINGGRMZM2G114461_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP1832967
Representative plantOGRP3012351
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.11e-118FAR1-related sequence 5